MZ@ !L!This program cannot be run in DOS mode. $PEL@>. ! h@d( T|.text_fh `.rdata l@@.datadL@.idata  @.reloc @B>UQE PfMQNfEfE]UQfEP_fEfE]3fT$D$fT$fD$ffT$D$3fT$fT$ffT$UQ} @H=@uZH%u Ht j;h\E}thTURt j:9u30H%T H PPTLH%H4u 930T74=t =4u93w4 +) 0 0i} uS=0~D00=uj t (; !93} u j] UQE} u=0u3} t} uB=tEPM QURE}tEPM QURE}u3~EPM QUR 9E} u}uEPjMQ} t} u@URE PMQuuE}t=tURE PMQEE] U=<t=<u=@u8EP8h0]U=thhhh]UjjEPp ]UjjEPP ]Ujjj2 ]Ujjj ]UQ=uEPPM |} uG=t,UEEM; rU:tEhhh$h ~=u j+ t"%}t7MQ]Uj 6:]Uj :]UE;E sM9tUEE]UQ94=4u3]jahljjtj] E}tEP 4Qu3&UR_MUB]U8=4t4P4]UE@PMA]UE4PE}uchhljjtjw E}t8MQ4Rt#EP}MUB j\EPE]U=4}u4PE}My$tjUB$PJMy(tjUB(P0My0tjUB0PMy8tjUB8PMy@tjUB@PMyDtjUBDPjMQj4R]U]U]UlhhxjhE}u jE` M$M`€9Us#E@MUB E@ÍMQU}}EMUUEEE}}MMEUUE EE ;MhhxjhE}u UdEM `  E$EM`€9Us#E@MUB E@WEMMUUEEM;M}gU:tZEtMUuMRt0EMk$`щUEMEMPvE EE}Mk$`щUE8MA}u EU҃UEPE}tXMQE}tEUEMuUB @MAUuEHUJEH@UJEHɀUJP]UE EE}@}yM<`tgU`E M$MU`9EsMyt U RjE `Q U`x]Ujjj8PMQX]UEPMQU R8PMQ2]UjjjE PMQ ]UQj 3EPMQUREP]Ej 3}u} uEMQ6u3몋]UjjjEP]USVWE`t0u!hljhAh`jC9u3ɅuЋdUE;hűMQUREPM QURjjpu^}t+EPMQh(jjjj8u3҅u&hhjjjj8u3u3(M t`uE}w E$v,MQh܀jjjjS8u3҅u3E %t@} t:M t,} t&hhjjjj7u3҅uڋE$EMQN6E}u3Wdd}tIEMAUBE@ MUQE@MAUE ; v =t MH UE UBEMHUEB MUQEM HUEBM j3ҊlREP&4 j3Ɋ lQUEL Q4 UR3tPM Q3 E _^[]UjjjE PMQ ]U E EE MQUREPM QE}t(UUEE EM;MsUEEE]UjjjE PMQ ]UQj .jEPMQURE PMQEj J/E]USVWE}uEPMQURE P}t} uMQURt3`t0i u!hljh9h`j4u3ɅuЋdUE;hűMQUREPMQU REPjpu^}t+MQURhjjjj4u3u&hĂhjjjjj4u3Ʌu3} v,U Rhjjjj84u3u3}tBMt4Ut&hhjjjj3u3uڋMQu!hpjhah`j3u3҅uɋE EMyuE}t>Uz u Ext!h(jhkh`jW3u3ɅudUB%uMuEUB%M;t!hjhrh`j2u3҅u}t%E $PMQ,:E}u3C#U $REPG9E}u3 d d}uVU+B M U+B M ;v M MUE ;Bv$MU +QR3tPMUQRd/ j3lPMM QK/ }uUEBMUQ EMHUE B}u/}uM;Mt!hjhh`j1u3҅uŋE;Et}tEM9tUMQP<;Et!hjhh`j#1u3ɅuϋUBMytUBM;;Et!hjhh`j0u3ɅuϋU=t UQEME@M E_^[]UjjjE PMQ ]UQj U)jEPMQURE PMQEj )E]UjEP2]UjEPB]Uj (E PMQj \)]UQSVW`t0u!hljhh`j\/u3ɅuЃ}ujjjU RjEPjpu+h0hjjjj /u3ɅuMUR u!hpjhh`j.u3uɋM MUB%tCMyt:UB%t*Myt!hjhh`jn.u3҅u`j lQUR uCE PMQREHxRh܃jjjj- u3uj lQUBMT R uCE PMQREHxRhjjjj- u3uMyulUz u Ext!hpjhh`jT-u3ɅuċUB$P3Ɋ pQUR* EP}6jMyu } uE UB;E t!hPjhh`j,u3Ʌu΋U+B `U:tEUBA> ;Mt!h8jh*h`jq,u3҅u΋EH UztEHU= ;Mt!h jh4h`j,u3҅u΋E UB$P3Ɋ pQURU) EP95)MAUBP3Ɋ pQU R) _^[]UjEP]USVW`t0u!hljh|h`jJ+u3Ʌuj T$URu!hpjhh`j +u3uɋM MUB%tCMyt:UB%t*Myt!hjhh`j*u3҅uExu } uE Myt2UB;E t!hPjhh`jV*u3Ʌu΋UBEj #E_^[]UQhEM hE]UQSVWj #EPtkM MUB%tCMyt:UB%t*Myt!hjhh`j)u3҅uEM Hj -#_^[]UQpEM pE]UQSVWEEMMt`U3M UU;tAE %PM3ҊQREPhLjjjj( u3ɅuE됋E_^[]USVWE`u 2j ![2E}}MMUU}E$_1hhjjjj*(u3Ʌuh|hjjjj'u3҅uvhXhjjjj'u3uNh4hjjjj'u3Ʌu&hhjjjj'u3҅uj 1!3EMU}EEHt#UztEHt UzuEHxUEjlPMQ u:U REHQURh܃jjjj& u3uEj lQUBMT R@ u:E PMQREPhjjjjU& u3ɅuEUzuPEHQpRE P u/M QhԄjjjj%u3҅uE}uvExt3MQ REHQURhjjjj% u3u͋MQRE PMQhjjjj% u3҅uEj E_^[]...o.UQ`E}t M `E]UQ`uQj  MUE}t$MQuE PM QUj p]UQ}t3E PMQu!}tU REPu EEE]U }u3|jj E P u3aMQURE P2 E}tM3Ҋt/3+H%tM Qj0R]UQEPcu3j M MUB%t"MytUB%t MyusjU REP t]MQ;U uREH; dD}t UEH }t UEH }t UEH j  j 3]UQ<EM <E]USVW}u+hhjjjj"u3u)j ME EE}}MUDEMDӋUEM}UB%|fMQ}UEHUDMQMDUB%MTEPMA%MT%URhąjjjj!u3uOMQ,E H0j _^[]USVWE}t } t}u.hhjjjj!u3uڋEE MM}UEMu T+TEMTUEMu T+TEMTUE|u MU|t%}t}u}u`tEmMU A,+B,MA,UE J0+H0UJ0EE_^[]USVWEj hhjjjju3uڃ}tMUEMU}E;E MQt-EHtUB%u `uUztpjjEHQ u*UB Phjjjju3Ʌu/UB PMQRhjjjju3uыMQRhjjjju3u؋MQuqEHQUB%PM Qhjjjjv u3҅uƒ=<tEHQU R< EPMyu=UBPM Qhjjjj u3҅uыEP[MQuJEHQUB%PM QhPjjjj u3҅u‹EPFj Gh8hjjjjmu3Ʌu_^[]U\SVWE EEMy} UBEEM;MUUB E=~hWMQu7EU3f PWM}tUUE EMLURh,EkLQ 6 6UDEPMQhjjjjRu3҅u_^[]U4SVWEPn}u}u `t=}t7h4hjjjju3҅uj3_^[]UQSVW}uE EE}}DMxREMTREMTRhjjjjS u3u뭋MQ,Rhljjjj)u3u؋MQ0RhLjjjju3u_^[]UE4EMt,E=t UUEP6MTUjUhjE Q,EUd=du j M4E MMMUtfMQt6EU=tGjahjMQUE8u j MQUP55MMj4R 4E]Uhhjtu tUEMMUREPjjMQtjuhjUE QE}u jUREPMUPMQUR$EXM \]UEMUU} tE MU U E"UUE"tzUtpM3Ҋ3t/ME}tMUMMUUEU }tEMEErME}tMUUE"u UUEU }tEMEEMUEEM3Ҋt/EU }tEMEEMMU tE%tM VUu EE }tMAEUt!M t E u UUߋEu} tU EM M UMEEU\uMMUUE"uQE3ҹu9}t UB"u MMEE3҃}‰UEEMUUt$}tE\MMUM̋Ut}uM t E u}}tTU33Ɋt)UE UUEEMEMUMM,U33ɊtUUEU EU EEm}tMUUEU } tE M M UM]U(j EPEM; uj/3}uj3E UU}8Ek0;ME U܃U܁}s EƀE MM}s{Uk0E¨M UUE3ɊtMU3BtAM3ҊU E܃E܋M3ҊQ9UwE܋M􊐩 E܈vM R)E EE}sMk0UEfAf Uj 3qUREP,E M܃M܁}s UƂ}EE M؃M؋U3tFM3ҊQt:E3ɊM U܃U܋E3ɊH9MwU܊ M܈E U܃U܁}sE܊U܈׋E QE UU}sEfEjy 3)=tj] 3 jO ]U}u 2}u}u`E]UQEEMM}w.E3ҊE$E 3]þEEEEEUQE EE}} MƁE UU}}EfE]U졬]Ujv]UEE=u= E}t "E}t 3=}u E}u3EEM3ft EEM3fu EEԋM+MMjWhȇjURE}uEP3MQUREP+ MQE_=R}uE}u36UUEtIjjjURj`PE}u3MMMUR*MTU뭋EEhhȇjMQE}uUR3EEMMUtuM+MU+REPjMQj`RujEP/MQ3CUR*MTUEP*MTAU끋EfMQE]UEE=u= E}t "E}t 3=}u E}u3EEM3ft EEM3fu EEԋM+MMjjjjUREPjj$E}t!hhȇjMQEE}uUR3jjEPMQUREPjj$ujMQEURE=}uE}u3EEMtEEMu EE؋M+MMh&hȇjURgE}uEP3%MQUREP|( MQE3]Ujhj,0=0u3u0P(3]UQEExthjMQREM}uҋ0R(]UEE}|,}~}t <MU<<EEE]UE@]U] U=<t=<u2=@u)h(=th ]USVWE EE}sMU;͐uދEM; Ő}t!UՔPjjjj ũ=<t=<ut=@uk=`t `yHt`BHLjLjMQUՔPw%PM͔RLP4}hQjuhR0$EMQ %}t8} t2} t,}t&U PjM R\뤡DP TQdR$P]UQE< uqhhĊjjlE}u jjM< uUR8EM jURj!E Q<]UE Q@]U}r"}PwE-P M Q<]U}}EP M Q<]U}r"}PwE-PG M Q@]U}}EP M Q@]UEPjDh]U%EEHPQURE}t ExuM QHxUzuE@[MyuJUBEMQTUEM HTUzXE MMX\9U}Ek MQPDЋEHXMU:uE@XM9u UBXqE8u MAXZU:u E@XCM9u UBX,E8u MAXU:u E@XMQXRjUEMHXUBEHQUUEBT]UQE EM;UtE E dk U 9Usءdk M 9Ms U;Et3E]UQj <EM <j E]U<]UQ<E}tMQUu3]̋T$ L$tG3D$Wr-كt+шGIuʃttGJuD$_ËD$U8PMQ]U}v3`}tEEEMM}wURFEE}u} uEEPu3뻋]UQE$EM; w1j UREj }tEEPj 0QL]U]UP]UQ}|}|>} u E,M tUEMU E]UQ}|}|c} u EQMU} ujM'} ujU EM E]UQ$EM $E]U,0(Wƅ3fƅ3fƅ3fE}|}|}hx`=@uBh\t hQ@=@uURE PhXQ@RXhxTk}t7PMQhR%}h,P}u2}t Dž DžQRPQ}u9UthQhRy} tBPMQU RhhP#}h,Q#RP =$t;QREP$ t}u hxTMt>E<t1jQRPPMR4E t RXE tn}tj REP DžQURPM QUR:}u hxT}u hxT3_]U8s$}u%ȟjhhjEu(3uhQjuhRYEMQ4@v)UR#MTUjhEP MtIR@v5PTjhP[ }u DžL DžHMt E DžHMt}u Dž8 DžHEt Dž DžH}t U DžH}t Dž0 DžH} t E DžH} t Dž( DžHt DžHt Dž DžHRPQRPQRPQREPMRhȋhP<}h,Qh hR uj$j u3]U} v3} v E $E E j LMQUREP E}tFEM ; w%U REPMQURtEEj E j M QURj0Pd]U}uE P[} uMQ3} w} vU U E E} `j QEPMQUR E}E ;M QUREPMQ tUUcE P;E}tKM3ҊUE;E sMMU UEPMQUR{ EPMQURw }ugE Pj 0QLE}tKU3EM;M sUUE EMQUREP MQUREP  j #j M QURj0PdE}u =8uEM Qu3b]U }udj EPMQUR E}t EPMQURZ j j EPj 0Qh]UQEj .V }Ej jj0Pu*xu]$xB$(EE]Ux]U]UE$E}wM 3]U =u E#h j0PLE}u3jh h@jlE}`jhhMQl1}u(=u =u )UE HUEHUEMHU@EPMUJEMA E UU}}4}}EMDUEDMUDhjEP[ MQ9Us-EMUBEƀMM‹E/hjUR}tEPj 0Qh3]UhjEHQ;Uu EH }t0UBMEUBAMQj0Rh ]UEMy#EEUELMUUEE}M9uph@hU EHQtMUDDMy t UB ;Ev MUQ EEMM}udUUEHM}tUUzuLEE EMMUU}} E8uہ}u MQEU;t }]UEEM;HvaUE;BsVMuHU3;r4M UE%EMUEM+UD 3EM}u3]UQEM +H UDEM3ҊEʋU EMAU:u DD=D u j]U EMy\UBEM MUE+ MQЉUEEMMU;UsiE;M|ZUB;EvOMQUPMQ- E}t'UE+MU EMHEUEBzMMUBEMQUEEMMU;UsiE;M|ZUB;EvOMQUPMQ E}t'UE+MU EMHEKUEBzMUE;EభMyUz EH MUE+ MQЉUEEEMMUUE8u}}jhM QURl;E jE PMQ EUUEEMMUUEEM;M}4UEMAUƂEMA릋UE 9EsM9t UUE 9E#MUJ EMHUEBM+UEMUD MUB+EMAE3}UE}భIE}tXMQUEMHUEMTE+MUJE%MQ+ЋEPE3]UEMUUEEMQ;UrcEMUU;UsEMU EH+MUJEMUBEM+U EHU3 t MUQUEE;EM3ҊEEEMMUUE3ɊuU;Us3E;Eu MUQE +EE M ;Ms3xUU^EE;EsMMU E+EMAUEMAUEMU+EM3ҊE‰EMMU;UEE;EM3ҊEEEMMUUE3ɊuU;UsE +EE M ;Ms3{UU[EE;EsMMU E+EMAUEMAUEMU+EM3ҊE‰E3]UEEM +H UDEM3ҊUE;Ev2MUE+EMЋEMAUUE;EMMU ;EEEMMM UUE;Es M3ҊuE;EMUE M;whU E;v^M 9Ms;U EEMMUUE3ɊuU EBM U E @M+MUMUUE]U(EE䰭;Eu MMUBE}EEMQUEEMM}UE|u.}uMUDM9A tU؃UZEM9r jU3=t NEEEE}MUD M;u UUEE3ɊHu U܃U܋EEMMUEM;L| }uUE;B} MMEUU EEMM3ҊQE9E}MM3ҊQtYʋEEMUE;Dt6}u)DMU}䰭}u3]U0SVWEE܍MMԃ}uhjj]hj@u3҅uփ} uhjj^hju3u֋MA BU܋EBM܋UE@MQU REP E؋M܋QE܉PM܃y|"U܋3ɁMЋU܋M܉URj&EЋE_^[]U E=wM3fJ#E M3fJ%t"MMUUEEEEEEjjMQUREPj&u3 E%#E ]W|$j...L$WtAt;u~Ѓ3ƒtAt#ttt͍y yyyL$ tAtdGu~Ѓ3‹tt4t'ttljD$_fD$G_fD$_ÈD$_ËL$tAt@u~Ѓ3ƒtAt2t$tt͍AL$+ÍAL$+ÍAL$+ÍAL$+UQEEM3fEEtE+E]UWVu M};v;xur)$tǺr $t$t$|tt5| s*؋ىUUUu3ɉ} Dž UU uEM׉M RPRP 0RPQR 9~MEERM+MM܋UUE%t)M0u}uEEM0U܃U܃E@tOMtƅ-E2Utƅ+EEtƅ E+M+MU uPMQRj PMQURPMt&UuPMQRj0}}EM܉||||tmffZfZPxQrtt&PMQtRxP0zQUREPMQUtPMQRj _^[]Ð*lۉ3B!ÉΉ։Њ Ŋ\)qu5   UQE HU JE x|&M EMMU M U REPE}u M UM]UE M M ~ UREPMQ\ U:u]UQE M M ~2UREPMUEPMM U:u뾋]UEU EA]UEU EQ]UEU EfA]U=uOEPjhXjxt ,MQjhTjjtt 3=uUREPM QURx=}EEE}u`EjjjjMQU Rh EP$E}u3+jvhHjMQj E}u3jjUREPMQU Rh EP$E}uhhHjMT R螄E}u}uPEMUfJEMfDAUREPMQUREPtEMU3fDJ=tMU3fJ=t EMQUREP jMQ舎jURzE]U=uOEPjhTjjtt *MQjhXjxt 3=u.}u PUEPMQU REPMQt=EE}u `UjjEPM Qj URE}uehhHjEPjE}u@MQUREPM QjURE}uEPMQUREPxEjMQE]UEjܵE EEM; U<t~MH t"U Q t UU}|=E  RjE R_E WjE]UQ}u j_*EP豵MQ%EURE]UEPDt'MQ @tEHQ<3]U EEEMQ uzEH tjUE +HM}~VUREHQUBP ;Eu!MQ tEH UJ EH UJ EEMQE@E]Uj]U EEj腳E EEM; U<MH U QURE B %tg}u%MP*t MM<}u6U Q t!E RuEE REPj}uEE]SVD$ uL$D$3؋D$ Aȋ\$T$D$ ud$ȋD$r;T$wr;D$ vN3ҋ^[SD$ uL$D$ 3D$3Pȋ\$T$ D$ ud$d$r;T$ wr;D$v+D$T$+D$T$ ؃[UQE;s"MUk$`Lu 2UREPM QUR' EEPE]U EPE}u MQjU REP|E}u EE}tMQ4:UEk$ `TEMk$`TE]UQE;s"MUk$`LuJ O2URKEPM QUR' EEPE]U EE}u3IMUk$`L tjjUR[ EMk$`D % M MEU+U ;UEM+ʁ}_E+E ;EsTMEE uE MMUMMjRE+PREMk$` P4t#MMU+9} EPjQURE PMUk$` Q4tEU E}}t.}u M UR>UEMk$`D @tM u3$ E+]UQSVW}uhjj.h\jγu3u֋ p pUUj;h\jhGyMAUztEH UJ E@%MQ EP MUJE@MUBMA_^[]UE;r3MUk$`D@]Uh`=thTjԫEEfE PMQ3E}t j@ hTE]U}u3=Pu.E %=~*aMU REEPj QURjE Ph  `Q$E}t}tR*E]UWVu M};v;xur)$8Ǻr $P$H$̥`#ъFGFGr$8.#ъFGr$8#ъFGr$8./ DDDDDDDDDDDDDD$8HP\pE^_ÐE^_ÐFGE^_.FGFGE^_Ðt1|9u$r $Ч$.Ǻr +$ئ$Ч0F#шGNOr$Ч.F#шGFGr$ЧF#шGFGFGZ$Ч.ǧDDDDDDDDD D DDDD$Ч E^_ÐFGE^_.FGFGE^_ÐFGFGFGE^_UQSVWE}uhtjj:hhjWu3u֋MQ @t E@ 'MQUR*EEP[E_^[]USVWEEE}uhjjwhhj迭u3Ʌu֋UB %t[MQHEURiEHQ*} E$UztjEHQ}UBE@ E_^[]UQE;s"MUk$`Luz UREMk$`D t;MQPu EE}uU EEPE]U VEj[E EE}@M<`U`E M$MU`9EMQExu9j٤MyuU R8EHUJjJE P<MQtE P@^MMUE+`$ȉM.}tjyhjhpE}ttEM `  E$EM`€9Us#E@MUB E@뿋MMUR*Qj9E^]UQE;MUk$`<uk=@uBMM}t}t}t(U RjE Pj M QjUEk$ `U 3A F]UQE;MUk$`LUEk$ `<tf=@u} tM QURXEk XXU:EE} E LU BC M Q_E dhԎdQ"``t)`+d\\t`;u&}tj3E EE}H\QdREk Q! uUk P,9\uhЎ```RM!\\u4`;t&}tjP3}K\P`QhRG \ƄhhQURt EE`\ddtddd8}t T DžTTMURjjhPM QE}E UU}\}tTEk QhR]t+hPMQt UUE EE땃}t%Ej QDs &}t P DžPPUE}tjxE]UEP`QXRdPM Qeu3Dh4h؎jdR菾PgE}u3 Ek MUHEjMkQUR `E荍dQUR1Mk XEHjXQUk¸R葾 }u ``Mk t7Uk E jMQqUEHM `3#}tjURrqEk ]UE= uhfh؎jhQf  E MMUk PhMk Rj P&}}FhЎ QܻUk PMk RWtE.}u &j Pmp $I]U}u3jECuOUBuDM CU B}tEfMfAUfB}t EE MQhURhPyEPxQ>t3xRhxP u33f  xRhJEtURhP?hhP+}tjhEP費 }tjhMQ虻 hU R]U3]UEEE MMU;U }EEMQREP葹E]U hjEPz M u3/E .u+U Bt M QU€R3E EEhM Q0E}uU UE}u%}@}M.tURE PMQK f}u(}@}"U_tEPM QU@R 8}u-Et M,uURE PMQ )U,uEuMU D E 3]UE PMQU B@tM @QhjURE tU €RhjEP]UQE;s"MUk$`Lu *UREPEMQE]UQVEPt=}t}ujj;tMQPt E EUREMk$`D }tEP3^]USVW}uhtjj0hju3u֋MQ tMEH t@jUBPkMQ EP MUBE@_^[]UQ=\jLhjhjdE}u EPt!MQjUR]jjE QjR.jE36X QjRi3]U E3fE3f M}uLURj1EPj0M ȉMURj2EPj0M ȉMU Rj3EPj0M ȉMURj4EPj0M ȉMURj5EPjn0M ȉMURj6EPjO0M ȉMURj7EPj30M ȉMU Rj*EPj0M ȉMU$Rj+EPj/M ȉMU(Rj,EPj/M ȉMU,Rj-EPj/M ȉMU0Rj.EPj/M ȉMU4Rj/EPjy/M ȉMURj0EPjZ/M ȉMU8RjDEPj;/M ȉMUEPj -M ȉMU„Rj?EPj,M ȉMUˆRj@EPj,M ȉMUŒRjAEPj,M ȉMURjBEPj,M ȉMU”RjCEPj`,M ȉMU˜Rj(EPj>,M ȉMUœRj)EPj,M ȉMU RjEPj+M ȉMU¤Rj EPj+M ȉMUREP0M ȉME]U}ujEHQ4djUBP#djMQ RdjEHQdjUBPcjMQRcjEQcjUB PcjMQ$RcjEH(QcjUB,PcjMQ0RzcjEH4QicjUBPXcjMQ8RGcjEHE}MMU¬UhPMQ+ E UU}snEMUEMREPQP8MTUEMUTEMTREPPMTUE EE} spMUED8MUD8PMQɒP谓UDEMUEDhMUDhPMQ蒒PyUDE끋MU쉑E􋈘QUR[PBMTUEM쉈U􋂜PMQ&P UDEMU쉑E􋈠QURPؒMTUEM쉈U􋂤PMQ輑P裒UDEMU쉑E^]UjEPMQU REP]U}u EMMUUE Eh`=thTjnEE}MU}t}%t_EEM#uEEMQUREPMQUPMMmU3 3fAt+}v%EMEEMMUUEMEEMMUU}t jn hT}vEE +E3]U VEEM%M}UGE3Ҋ$MQURE HUP MQURE HUDP MQURE HUD8P MQURE HUDhPz =tMQUREPM QUPM9uhU MEMEMQUREPM QUPsMQUREPM QUP{M9uU MEMEMQUREPM QUP*  UREPjM Q RMQURjE HQxXE @ U}uE UREPjMQ3EPMQjU BP  UREPjM QRMQURjE HQU z EPMQUP9 MQUREQ MEPMQjU PD$  U BER  UREPjM QRM yu E U BEM Q;U} E-E @EU B;U| UUEPMQjUR_=t.EPMQURE PMR"EPMQURE PMREPMQURE PMRPM AdUUREPjMQE @dȃkdU BdʉMEPMQjURjMEPMQU 3z  Q "U%MEME^]fu0;d;Su{);  UE8t;Mt1E UM E MMUM]UQE=tEPMQUR EM ;slU U E E M t2E 0EE E EUU뻋EMU E+MU E]U E MU:vEE 0EMMUME E}~U:wE MU EMMUEMUMMUEMMU;Ur̋]U,EU:|EEEE MMUMMM;u܋UUEMU'U}RjM3$UUEE}w$M$Em EbEBUUEE}w$M$/Ed EaEAUU}t}t EyEYEE}t}t EIMM܃}t}t EHkUU؃}t}t EMDEEԃ}t}t EShMQ u UUhEP_ u MMEpUEEEME8M'u EEM3Ҋ3f Pt/UMEU EEMEME UMUUEU Q EEEMt$UREPMQU REPMM{U3 3fAt/EUMEMMUMUMEU EEMEj]^7          U}VEptMEDžljlREPMQU RE}ztjjjEPM QllujXhjlRq-E}uEjlPMQURE P?E}u^jchjMQ-pp8u4MQURpQ1 }tjURm739}tjEPR7}Dž\Mdj\RhEPM QudDž````=~1j`Mhh%PX3`Mhh% 3fAXXt!dk hDЋdF3]U@]U =uCjjjjt %jjjjt 3=uEPMQU REP=E}u `MjjU REPE}u3jdhjMQ*E}u3UREPM QURua}u#jjjEPjMQE}u:%UREPjMQjURE}ujEP4EjMQ43]U =uCjjjjt %jjjjt 3.=uEPMQU REP =E}u `MjjU REPE}u3hhjMQ.)E}u3UREPM QURuo}u*jjjjjEPh MQ$E}uA,jjUREPjMQh UR$E}ujEP(3EjMQ33]UjEPM QUR ]UEEEMffUEEjfMQNtUffEMM؋U-uE EMffUEE!M+uUffEMM}| }t}$~} tU E3 }uAM0t E *U3fxt M3fXu EE}uCE%0u6M3fxt E3fXuUUEffMUU3uEjfEPtM0M2hfURtfEPp %7E_M;MrUUUE;ErM;Mu3u9UwUUUUE EMffUEEKMMUu} tEEErMu0Uu^Et }wMuA}v8討"Ut EEt EE} tM UEtMىME]UjEPM QUR ]U=~jE3ɊQzEU3 3fAU}t EE붋M3ҊUEEMM}-t}+uU3EMME=~jURyEE 3fAU}t%Ek MTЉUE3ɊMUU뤃}-uEE]UEP]UV=~jE3ɊQxEU3 3fAU}t EE붋M3ҊUEEMM}-t}+uU3EMMEE=~jURexEE 3fAU}t;jj EPMQ! ȋE0MuU3EMM뎃}-uE؋UEU^]UWVSu }Hxu; t.F'G8t,A<ɀ A,A<ɀ A8tx=j jU$3ې t'FG8tPS' ؃ 8tX u  jJV[^_U=u/j U=u<j V]Uj VUj U]UEj ,UhXE}j Uh k< P3fNt\k< Pȉ P3ft(=tT+\k=~jMQjEU3f PM}uEU3f Pt"UUEEEEMMEEjjUREPMQhPR"E}uE&}u E%E%M ]Uh`=thTjTHEEEPM QUR0 E}t jH hTE]USVWEE}t }u3} uhhjj~h\jNu3uփ}"=PugM;MsWU 3f=~|*MMMU M 3fE E uE#MM롋E=}vURE PEMQjUREPMQU Rh `P$E}t%}uMMQu EEE|*MQjUREPjM Qh `R$E}t}u EB}u zt{*E;EMQjREPjM Qj`R$E}t}tZ{*EE;EvEEMMUUE;E}#MMUDMMuEsËE E EE^=PuM QiGURjjjjE Ph  `Q$E}t}tz*E_^[]UE EMMUU}tE3ft UUڃ}tE3fu E+EE ]UQj DEPEj EE]UdE}u"=ltt3 dM}tt}tnUREgEE8tWMR,g;Ev9EU=u(MQUREQP uUMD UU3]U=uWjjjhXhjt /jjjhThjt 3=}~EPMQ7E=u#UREPMQURE PMQ=EE} u `U jjjjEPMQh U R$E}u3hhxjEP'E}u3wjjMQUREPMQh U R$u-jjEPMQU REPE}uhhxjMQE}uUREPMQURE PMQuU t8EE}t*M;M}UUEEMQUREPsi R}u%jjMQURjE PE}uJ'MQUREPMQjU RE}u!jEPajMQSEjUR@jEP23]UE EMMUEEtM3ft EEًM3fu E+EE ]U=uWjjjhThjt /jjjhXhjt 3N}~EPMQGE=u#UREPMQURE PMQ =EE} u `U jjEPMQj U RE}u3hmhxjEP E}u3MQUREPMQjU RuJjjEPMQU REPE}u"M t?}t4U;U~EPMQUREPM QURuEEhhxjMQS E}uUREPMQURE PMQu}u,jjjjUREPh M Q$E}uQ.jjUREPMQURh E P$E}u!jMQ@jUR2EjEPjMQ3]UE EMMUEEtMt EEۋMuE+EE ]UQ}u3=PMQU REPMQjRE}uE]U lEM9jjjjjUPjj$E}uhj=hjMQ| E}uEjjUREPjMRjj$ujEP)MMf3]U=uWjhXjhXjjt /jhTjhTjjt 3(}~EPMQ'E}~UREPE}t}u1M+Mu EU+U3H$EE=u#MQUREPMQU REP=EEE} u `M jjjjUREPh M Q$E}u3-hhjURE}u3jjEPMQUREPh M Q$ujjjjUREPh M Q$E}uhhjUR)E}ukjjEPMQUREPh M Q$uBUREPMQURE PMQEjURVjEPHEjMQ5jUR'3]UE EMMUEEtM3ft EEًM3fu E+EE ]U,SVW=uWjhTjhTjjt /jhXjhXjjt 3J}~EPMQDE}~UREP+E=u#MQUREPMQU REP=EEEEE} u `M }t }|U;Uu }~ {}~ kEPM Qu3R}u}t-}u}t!hjhbhj>u3҅u}~s}s EމE MԃMԋU3t=M3ҊQt1E3ɊU3;|M3ҊE3ɊH; 미}~s}s UމU EԃEԋM3Ҋt=E3ɊHt1U3M3Ҋ;|E3ɊU3B; -미!jjMQURj E PE}u3hhjMQOE}u3UREPMQURjE PujjMQURj E PE}uhhhjMQE}uCUREPMQURjE Pu!MQUREPMQU REPEjMQ jUR E_^[]UE EMMUEEtMt EEۋMuE+EE ]UV}tj=EP8E}tM;MuUB@E d; hudRd=d} t=lttI}t37=du7hhܖjjPd=dud=lu8hhܖjjl=lu ldUE+EPMQE}U:}tsjEMR/  EEMU<tEMUuThhܖjEPMQE}t Ud EMUs}uf}}E؉EhhܖjMREPE}uMUEMUDEd3} thhܖjMQ1VPE}tRUREPUM+MUщUEMMU#UREPjMQ 3^]UQdE MMU:tKE PMREP u/ME  =tUM uE+d뤋E+d؋]UEEE}u3MEEt MMhFhܖjUPWEMM}u j ~UUE8t[hOhܖjMRTP MU:tEQUPSMMUU띋EE]UQ=uE PMQj1 UUEffMUt|E%3ɊtPUUE3ɊujO13aUE3Ɋ 9U uj'1E5U9U ucj0E%9E uE3]̍B[...3D$ST$t B8tфtQu WV ؋ ~333ƃu%t%uu^_[3ËB8t6t8t't8tt8tt^_B[ÍB^_[ÍB^_[ÍB^_[%0%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%% %$%(%,%%4%8%<%@%D%H%L%P%T%X%\%`%d%h%l%p%t%x%|%%%%%%%%%%%%%%%@>.@>.`@>.,IsTNTkernel32.dlltidtable.cioinit.cClientIgnoreCRTNormalFreeError: memory allocation: bad memory block type. Invalid allocation size: %u bytes. %sClient hook allocation failure. Client hook allocation failure at file %hs line %d. dbgheap.c_CrtCheckMemory()_pFirstBlock == pOldBlock_pLastBlock == pOldBlockfRealloc || (!fRealloc && pNewBlock == pOldBlock)_BLOCK_TYPE(pOldBlock->nBlockUse)==_BLOCK_TYPE(nBlockUse)pOldBlock->nLine == IGNORE_LINE && pOldBlock->lRequest == IGNORE_REQ_CrtIsValidHeapPointer(pUserData)Allocation too large or negative: %u bytes. Client hook re-allocation failure. Client hook re-allocation failure at file %hs line %d. _pFirstBlock == pHead_pLastBlock == pHeadpHead->nBlockUse == nBlockUsepHead->nLine == IGNORE_LINE && pHead->lRequest == IGNORE_REQDAMAGE: after %hs block (#%d) at 0x%08X. DAMAGE: before %hs block (#%d) at 0x%08X. _BLOCK_TYPE_IS_VALID(pHead->nBlockUse)Client hook free failure. memory check error at 0x%08X = 0x%02X, should be 0x%02X. %hs located at 0x%08X is %u bytes long. %hs allocated at file %hs(%d). DAMAGE: on top of Free block at 0x%08X. DAMAGED_heapchk fails with unknown return value! _heapchk fails with _HEAPBADPTR. _heapchk fails with _HEAPBADEND. _heapchk fails with _HEAPBADNODE. _heapchk fails with _HEAPBADBEGIN. Bad memory block found at 0x%08X. _CrtMemCheckPoint: NULL state pointer. _CrtMemDifference: NULL state pointer. Object dump complete. crt block at 0x%08X, subtype %x, %u bytes long. normal block at 0x%08X, %u bytes long. client block at 0x%08X, subtype %x, %u bytes long. {%ld} %hs(%d) : #File Error#(%d) : Dumping objects -> Data: <%s> %s %.2X Detected memory leaks! Total allocations: %ld bytes. Largest number used: %ld bytes. %ld bytes in %ld %hs Blocks. stdenvp.cstdargv.caw_env.cruntime error TLOSS error SING error DOMAIN error R6028 - unable to initialize heap R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data abnormal program termination R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point not loaded Microsoft Visual C++ Runtime Library Runtime Error! Program: ...mlock.cAssertion FailedErrorWarning%s(%d) : %s Assertion failed!Assertion failed: _CrtDbgReport: String too long or IO ErrorSecond Chance Assertion Failed: File %s, Line %d wsprintfAuser32.dllMicrosoft Visual C++ Debug LibraryDebug %s! Program: %s%s%s%s%s%s%s%s%s%s%s (Press Retry to debug the application) Module: File: Line: Expression: For information on how your program can cause an assertion failure, see the Visual C++ documentation on asserts.dbgrpt.cszUserMessage != NULLformat != NULLsprintf.cstring != NULLGetLastActivePopupGetActiveWindowMessageBoxA_file.cvsprintf.cwinsig.c("inconsistent IOB fields", stream->_ptr - stream->_base >= 0)_flsbuf.cstr != NULLEEE50P (8PX700WP `h````ppxxxx(null)(null)output.cch != _T('\0')aw_str.c_getbuf.cfclose.cstream != NULLosfinfo.cLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALL;=;setlocal.c=_.,.__freebuf.cinittime.cinitnum.cinitmon.cinitctyp.cunited-statesunited-kingdomunited statesunited kingdomtwnturkeyturtaiwanswitzerlandswedenswesvkspainsouth-koreasouth koreasgpsingaporerussiaprtpr-chinapr chinaportugalpolandpolnzlnznorwaynew-zealandnew zealandnetherlandsmexicomexkoreajapanitalyirlirelandicelandhungaryhong-konghong konghollandhkggreecegreat britaingrcgermanygbrfrancefinlandenglanddnkdenmarkczechnchinachecanadacanbritainbrazilbrabelgiumbelautaustriaaustraliaausamericausausukturkishtrkswissswedishsvespanish-modernspanish-mexicanspanishslovakskyrussianrusptgptbportuguese-brazilianportuguesepolishplknorwegian-nynorsknorwegian-bokmalnorwegiannornonnldnlbkoreankorjpnjapaneseitsitalian-swissitalianitaislirish-englishicelandichungarianhungreekgerman-swissgerman-austriangermanfrsfrench-swissfrench-canadianfrench-belgianfrenchfrcfrbfrafinnishfinespesnesmenzenuenienglish-usaenglish-usenglish-ukenglish-nzenglish-ireenglish-canenglish-ausenglish-americanenglishengencenaelldutch-belgiandutchdeudesdeadanishdanczechcsychtchschinese-traditionalchinese-singaporechinese-simplifiedchinese-hongkongchinesechichhcanadianbelgianaustralianamerican-englishamerican englishamericanOCPACPH:mm:ssdddd, MMMM dd, yyyyM/d/yyPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSuna/pam/pminithelp.caw_loc.cSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDectzset.cTZwcstombs.cpwcs != NULLaw_map.cwtombenv.caw_cmp.ccchCount1==0 && cchCount2==1 || cchCount1==1 && cchCount2==0setenv.cDLL FOR 8255 CARD@>.ܜȜМ؜8255.dllIn8255Out8255xy@ `y!@~ڣ @ڣ AϢ[@~QQ^ _j21~8   `<؈x@xyzԇ  x Ůȭȭ ((((( H .          ! 5A CPR S WY l m pr   )    $CȎ0p0CCH    xl h d\H 4   ؓȓē       x l ` T H D @ < 8 4 0 , $         ܒ ԒĒ  |xp`\PLH@<840$̑ȑđ   xpld` \ X HPL=@=8+4+0 ( $77,)VV**-1-,0",fؐf !А!̐,Đ1,TTT$|$tblaha|bx'`'XQLQHRPRL4D48,@ @80//@@ 00_VV܏_ԏȏAďA*RR"*..)v|ZtZpv`,`,P@,0\X            ܕؕԕЕȕ|xtplhd`\TH@8x0(  ДȔX.pPSTPDT`;Zx0Nm:Yw/Ml(2DXft*:HZr $<Vlz &4Lbr&.<L^t2DXft*:HZr $<Vlz &4Lbr&.<L^tGetCommandLineAGetProcAddressGetModuleHandleALGetVersionkExitProcessFTerminateProcessGetCurrentProcessGetCurrentThreadIdKTlsSetValueHTlsAllocITlsFreeSetLastErrorJTlsGetValueGetLastErrorGetCurrentThreadSetHandleCount*GetStdHandleGetFileType(GetStartupInfoALDeleteCriticalSectionIsBadWritePtrIsBadReadPtrvHeapValidateGetModuleFileNameAGetCPInfoGetACP GetOEMCPFreeEnvironmentStringsAMultiByteToWideCharFreeEnvironmentStringsWGetEnvironmentStringsGetEnvironmentStringsWnWideCharToMultiBytelHeapDestroyjHeapCreate^VirtualFree{WriteFileyInitializeCriticalSectionXEnterCriticalSectionLeaveCriticalSectionsFatalAppExitAPUnhandledExceptionFilterhHeapAllocHDebugBreak{InterlockedDecrementOutputDebugStringALoadLibraryA~InterlockedIncrementqHeapReAllocnHeapFree[VirtualAllocSetConsoleCtrlHandler+GetStringTypeA.GetStringTypeWSetFilePointerFlushFileBuffers)SetStdHandle?SleepCloseHandleIsValidLocaleIsValidCodePageIGetUserDefaultLCIDGetLocaleInfoAGetLocaleInfoWHGetTimeZoneInformationLCMapStringALCMapStringWCompareStringACompareStringWSetEnvironmentVariableAKERNEL32.dll(000011"101:1]1j1p1|1111111111122&2/282>2222n33333333334 44444444455$5)575Q5m5{55556%6,6F6z666666666 77(7M7e7w7~7=8D8U8e8|88888d9w999999X:r::: ;;;;;; <<*L>>>>>E?N?S?[?a?g?o?u?{?????? 0"0111111 20252g22222B3N3334'454=4C4L4T4\4b4k4q4w4~44445#5l5v5555555566636(7=7I777777+878R8e888899E9Q9y999999:(:4:V:t:~::::::;O;[;;;;;Ck>p>u>>>>>>>??J?????00J00001_1c1g1k1u1111$2<2222y33344I445F5R555E6666I7777)8K8b888-92999 :M::::0;L;v;;;1?@0$1x14222263<3E3W3]3k33333R4]444444444555E5O5]5g5u5~5555555546=6G6n666666667d7777778G8j8888969?9N9Z9i9|999 :-:R:u:::: ;-;N;S;Y;n;u;;;;;;<<<7>D>]>w>>>>>>?????!?R?w?~????????????P0'040X0_0y000000011171c1{111)2=2C2o333333445s5z5555536?6P6Z6j6t66661777E7M7S7g7t7y777777778+8g8s888889'9-9B9S999999::/:5:T:`::::5;T;`;;;;;;;;;<'<3>J?Q????`xw0~0000$1L1h1r11111111112222%233-343S3Y3j3q33333:4L4T45)55566'66g777988b99>>p0\0e000X1~1333344 454[4u4|4444444444444Z5e55555555 6666 6$6(6,606z66666666 777 7,767;7@7J7O7U7^7m7z77888888888999$9T9]99999<<====> >7L778c8888899::Q;X;<>>3333344 4 44444!464:4>4B4F4y4}4444444444444444x66666666667=7T77778888888888 9989S9h999::+:C:l:y:::e>.?=?v????x00111112l22222 3333333364<4e4444(5@5G5O5T5X5\5555555555552686<6@6D666666667+7]7d7h7l7p7t7x7|7777777E8N888999: :::: ;2;M;n;;;;;;Y2>>>.?f?????0N0V0\0g001_1h1111%2.2B33334O444444455+5>5Y5b5m5555555566$6*6B6O6p6y6667.7h777777777 889:A:i::+;>;c;;;6?#?+?5?P?i???T002080,111111111N2R2X2\2c2t22244r55677888J99v::;=g>000000!161y111H2O22233 442484w4}44444=5C5f5l5}5555+64666666W77777777777777777777777778&:::::::M;t;;;;;i<%============>#>'>+>/>3>7>;>>>2??#050d0{000011!141M1X1r111112h2y222222223!3W3337?77798`888n9999:5:H:U:]::::::::: ;;;$;-;5;>;H;Q;Z;`;h;p;z;;;;;;;;;<<4<:<>J>V>f>s>|>>>>>>>>>>>??,?5???I?T?^?h???????0#010?0T0b0|0000001@1O111 22;2_2h2u2222222222222233&3_3e3k3s3y3333e44455555566(6W6u667W7]7c7k7q7778 808888G9N9t9999R:~::g;v;;(<6u>8?F?S?]?n?{??????030o000081f11O2h22223H3R3Y3c3m3z3333484C4k44445(5d55K6U6\6f6p6}666666 7?777789<9]9r999:::::::;;;*;6;C;T;Z;k;w;;>> ^0d0j0p0v0|000000000000000000000011 1111$1*10161<1B1H1N1T1Z1`1f1l1r1x1~1111111111111111111111T 360:x:|::::;;;;;;;;;;;;;;< <<<$>>>>> >$>(>,>0>4>@>>>amsDebug/8255.dll TXrr{wNB10@>.C:\PORT\8255\Debug\8255.pdb
Make your own free website on Tripod.com